PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA11g05650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 152aa    MW: 17800 Da    PI: 6.8044
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA11g05650genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.13.5e-194194356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                k++++ ++q++ Le+ Fe +++++ e++ +LA++lgL+ rq+ +WFqNrRa++k
  CA11g05650 41 KKRRLLPNQVQFLEKSFEVDNKLDPERKVQLANELGLQPRQIAIWFQNRRARYK 94
                45578899*********************************************9 PP

2HD-ZIP_I/II126.41.2e-4040131192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl  +qv++LE+sFe ++kL+perKv+la+eLglqprq+a+WFqnrRAR+ktk lEkdy++Lk+++d+lk++ ++L ke+e+Lr+e++
   CA11g05650  40 EKKRRLLPNQVQFLEKSFEVDNKLDPERKVQLANELGLQPRQIAIWFQNRRARYKTKVLEKDYDVLKASFDKLKADYDNLFKENEDLRNEVS 131
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.8763696IPR001356Homeobox domain
SMARTSM003892.4E-1939100IPR001356Homeobox domain
SuperFamilySSF466898.98E-1940106IPR009057Homeodomain-like
CDDcd000862.07E-164196No hitNo description
PfamPF000461.5E-164194IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-1944103IPR009057Homeodomain-like
PRINTSPR000313.9E-66776IPR000047Helix-turn-helix motif
PROSITE patternPS0002707194IPR017970Homeobox, conserved site
PRINTSPR000313.9E-67692IPR000047Helix-turn-helix motif
PfamPF021833.8E-1596131IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MVNFEDGGRG EIAKERPFFP AIDKEETGND DYDSCFHHPE KKRRLLPNQV QFLEKSFEVD  60
NKLDPERKVQ LANELGLQPR QIAIWFQNRR ARYKTKVLEK DYDVLKASFD KLKADYDNLF  120
KENEDLRNEV SSNSLQNQHS RLALQLPKGF I*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754441e-142HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016548225.11e-90PREDICTED: homeobox-leucine zipper protein HAT5
SwissprotQ022832e-41HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLM1BHQ13e-86M1BHQ1_SOLTU; Uncharacterized protein
TrEMBLA0A0V0I6664e-85A0A0V0I666_SOLCH; Putative ovule protein
STRINGPGSC0003DMT4000454716e-84(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.11e-42homeobox 1